SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 543728.Vapar_1973 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  543728.Vapar_1973
Domain Number 1 Region: 27-137
Classification Level Classification E-value
Superfamily HSP20-like chaperones 3e-26
Family HSP20 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 543728.Vapar_1973
Sequence length 139
Comment (Variovorax paradoxus S110)
Sequence
MDSSNTPSTSTRAAGSKELARKDDSTRYSDAALTPPVDVVEDSGGITLFADLPGVSRDKL
SLQVASDTLTIEAESGLSIPEGLESSHTEVGLGRFRRVFTLSKELDTNAISAELSQGVLK
LRIPKAQHAQPRRIEIQAA
Download sequence
Identical sequences C5CVH0
WP_012747105.1.44240 gi|239814975|ref|YP_002943885.1| 543728.Vapar_1973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]