SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 543734.LCABL_17300 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  543734.LCABL_17300
Domain Number 1 Region: 73-223
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.12e-42
Family RecO C-terminal domain-like 0.025
Further Details:      
 
Domain Number 2 Region: 2-66
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000171
Family Cold shock DNA-binding domain-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 543734.LCABL_17300
Sequence length 247
Comment (Lactobacillus casei)
Sequence
MSRQNYRESDMLVKILTDRFGKKMFLLNRARKPGFTLGAGILPFTHADYIGEVRESGLSY
LSAIKNATQYRQISDDITLNAYAAYIFGLIDLAFPDGRPVGFWFNQIKQALYLIDSGLDP
QIIANVIEVQMLKEYGVEPNWRGCVIDGRADLPLDFSESYGGLLCQNHWDKDPHRLHASP
RVIFYLRRFSTLDLGKVERINVKPDTKAELRRILDVIYTDMVGVTPKAKRFLDQMQQWQD
RLPDDSE
Download sequence
Identical sequences 543734.LCABL_17300 gi|191638503|ref|YP_001987669.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]