SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 544556.GYMC61_3420 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  544556.GYMC61_3420
Domain Number 1 Region: 3-72
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 1.39e-25
Family F1F0 ATP synthase subunit C 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 544556.GYMC61_3420
Sequence length 72
Comment (Geobacillus Y412MC61)
Sequence
MSLGVLAAAIAVGLGALGAGIGNGLIVSRTIEGIARQPELRPVLQTTMFIGVALVEALPI
IGVVFSFIYLGR
Download sequence
Identical sequences A0A063YL70 A0A063Z0Z2 A0A0D8BTZ1 A0A0E0TGM3 A0A0J0V8K8 A0A0K2H8J3 A0A0N0Z4R5 A0A0Q1DS42 A0A142D4D1 A0A150MNW4 A0A150NAU7 A0A1C3D5F9 A0A1V4PC32 A0A1V9CTV8 A0A2H5KIQ5 L7ZWN8 P00845 Q5KUI8 S7SV57 T0NRG1 V6VIL9
gi|319768438|ref|YP_004133939.1| 235909.GK3363 544556.GYMC61_3420 WP_011232830.1.100150 WP_011232830.1.13089 WP_011232830.1.13458 WP_011232830.1.17728 WP_011232830.1.19233 WP_011232830.1.20723 WP_011232830.1.2219 WP_011232830.1.22479 WP_011232830.1.22874 WP_011232830.1.24107 WP_011232830.1.25743 WP_011232830.1.25789 WP_011232830.1.30801 WP_011232830.1.3446 WP_011232830.1.38260 WP_011232830.1.38928 WP_011232830.1.43576 WP_011232830.1.44827 WP_011232830.1.45808 WP_011232830.1.46340 WP_011232830.1.50933 WP_011232830.1.54348 WP_011232830.1.56669 WP_011232830.1.57889 WP_011232830.1.59104 WP_011232830.1.60903 WP_011232830.1.6497 WP_011232830.1.65208 WP_011232830.1.70239 WP_011232830.1.72400 WP_011232830.1.76536 WP_011232830.1.77642 WP_011232830.1.78869 WP_011232830.1.80994 WP_011232830.1.8599 WP_011232830.1.86012 WP_011232830.1.90668 WP_011232830.1.91533 WP_011232830.1.9165 WP_011232830.1.92435 WP_011232830.1.93593 000159226|e1wu0A1|5041.1.1.1|A:1-72 cath|current|1wu0A00/1-72 1wu0_A gi|297531563|ref|YP_003672838.1| gi|448239641|ref|YP_007403699.1| gi|56421898|ref|YP_149216.1| gi|261420768|ref|YP_003254450.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]