SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 546414.Deide_12990 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  546414.Deide_12990
Domain Number 1 Region: 146-257
Classification Level Classification E-value
Superfamily Globin-like 3.36e-24
Family Truncated hemoglobin 0.0038
Further Details:      
 
Weak hits

Sequence:  546414.Deide_12990
Domain Number - Region: 22-91
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.00055
Family Class I glutamine amidotransferases (GAT) 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 546414.Deide_12990
Sequence length 272
Comment (Deinococcus deserti VCD115)
Sequence
MCLALRVLTLSPLPGLPLVMSSDLARCGGLLVPHDGEPVGDVRDRPDRWAALQLLTQAIR
RGVPVLAWGSGAALAGRALGSAVEQTDGLEWAQAPRNAEVLVWRQERPQHWQVGRVNAWA
SPEMPAELAAAFLSTLPAQRSRQPASPLEAVGGEAALRPLLADFYARARTDELLGPVFTS
HVTDWHAHLDRVTAFWVTMLGGGPAWRGNLNAAHAGLGVSSAQLERWLTLLAQAAHAHLP
AEAAEVLLTRAHAMARQLGRRGKRESAGTRRC
Download sequence
Identical sequences C1CVK3
WP_012693343.1.1337 gi|226356234|ref|YP_002785974.1| 546414.Deide_12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]