SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5476.CAL0003156 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5476.CAL0003156
Domain Number 1 Region: 913-1049,1080-1298
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.47e-40
Family p120GAP domain-like 0.0069
Further Details:      
 
Domain Number 2 Region: 177-330
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-36
Family Calponin-homology domain, CH-domain 0.0000536
Further Details:      
 
Domain Number 3 Region: 1543-1643
Classification Level Classification E-value
Superfamily RGC domain-like 3.01e-25
Family RGC domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5476.CAL0003156
Sequence length 1647
Comment (Candida albicans)
Sequence
MAIGNIAARYLSSLEETDTTATTTTTTTSNVLQPSNRLNSPTKFNRKSLDNNSQDLDALA
RALNITPSKPETPTSISKGSATSLLRTKFESPSATVSSFKSTSSSNGVSPTKKNHFVEIT
SDETPSWANKNYKDILNKSPTKFNTQSNVHTPLKQLNQPIGTPSSSSLSPAKNASKSSPG
YEYLCRIEAIKQWLESVLQEQITQSASQLISYIRNGIHLAKLANVVLPTSKPVFLNDSKL
QFKHTENINRFFQLLDFFNMPDLFRFELTDLYDAKNVPKVWFCLHALSYILHKQDPSYPA
MNNLVGKVDFSADDIRTANRALVNSPLPNFSSADTGEGKSDTSNNNSSTTSATAAFMDKV
TSPVKKTPSPLKRPQQLQKKQLELVEDNKPELTQDSSGLSKISRDDPFTDRVDLAPPSTS
NAKLELHTPPSKSLEFKIKSPIIDLSHRDSDYYTPELESHLPNIIKFQSLARGAVFRYLM
FVDRILLKSYQDEFTNLFAIIRGNKARRKTVHKHRDELRLYSFEIIELQSIIRKNFVINK
KPNFTSITNDVETVELQSLIRGKLTRDWKKYVTNGLEKFTPQIIDFQSLVRMKSIYSKSN
KVISYKDEILPSLIELQSIARSQLYHRFSRSNAIDETEIIKIQSIIRRNAVIEDLYTKLS
KVRSNKRRLIELQSIARGGVARTKLCNSVLVTLIYEDGILNQLFAKIRGDNYRKKFNSQK
SELLKYEKSSIIPVQTLFRGVLSRYTKEVTLSDIFDQIDSVITLQSVARGKLMRGSIYEF
SDYYQKHIKQVVKAQAILQRVFAQNAYKQLITSKNPPLKVIRRFAPLLSNNDRDFQDEMT
LSDLKDLIIEKCKANEEYENQIEQLDMKLGLLDKNKISIEEFLKPTKGKTFKPIVENVKN
LERLNKSLKKKIELWQTLFYFIQTNPIYLTKLFNSIPYTKNQTKSGQDLFQSVIQLFPVR
DSSITYHSREEYFLVKLMIQLMQNDTANSNNLGDITKLHLTNWIDFFTNFNNHTFQRQHL
KALLGKFVIRIVDNEQVDFESDPIRIYNQIIDHEMKVYGRSEKSRDISPQAAIQLPEVSN
KFVGNLMSLRETCSDLLSMLQKNASGNKALLQIPDHVKLICRQGYLCAQRKFPDKSDQQH
LAVAGVIFVKHYLGSILQVPENYGILTGNNDTQKAKSKDNLRYLYRVMLQLFSMKPFNDN
FLKPLNEYIMASTDTVKSIISQAIINVGEIETVYELHDYDDLVTHQRPKLTISVNSLIQL
EKSILQNVDIITTGNDDQLYKTCVEVEKLLISPQDMLTLTDLSSVTLNLNPTTQEESIVD
SKTKTLFTQAKRCLLYIIRVQEEDDSDDLLELLISGIKPSHEQRFKEIVQYEKAEQDISL
NNSKSVTANTVNKKKSTRPYSGTSLGDLSNLTYHELKKMCLEIILKLESMGELTRKNSFQ
TLLNQIAMDIKTKDSQRQCRWQQLQVSQKTIKKLSEKENYLKTQLHNYNKHVESVLLELQ
SKSKSNDKNWKRRLFNIMVIPVFSKQYFYHRELRKHNRLPKFGSYKYSAKKLIDQKVLID
FSTANNVATASKLDFMFSCHQVGKFTIEVASGTVNIPGATNTITLDELLALQYENKTKFE
LFDGMATFDSNNFMGLIFRKFYDLKKE
Download sequence
Identical sequences G1UAF6
CA4939 5476.CAL0003156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]