SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5476.CAL0006349 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  5476.CAL0006349
Domain Number - Region: 12-131
Classification Level Classification E-value
Superfamily Cgl1923-like 0.00458
Family Cgl1923-like 0.043
Further Details:      
 
Domain Number - Region: 169-208
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0573
Family Insect pheromone/odorant-binding proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5476.CAL0006349
Sequence length 264
Comment (Candida albicans)
Sequence
MKSSSGTSLRKVFNPDLKHSTLIIPSVSIGNVPQLAIDLLIHTHNLEKVDSLDDLYLYPF
ASPVDYVTEPKKGISHAAEVFHNKDLNLTLIQQRSPILPYNTKLYVTNIIIPFITSHEFD
RILILDSSDAGLVEHISSGGIELYTKEDLLSESLESMKLSKEESTTAAHEDNRNSKYVRC
LLENFNLSTDSNESHSNEFKDVVIDLLVSYVYEGDNFYDGENLANKVNSVLSLPAVQKWV
RPVSWAGVYGDKPVPNAMEQGLYG
Download sequence
Identical sequences CA0256 5476.CAL0006349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]