SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5518.FG05677.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  5518.FG05677.1
Domain Number - Region: 12-96
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 0.0706
Family Chemotaxis phosphatase CheZ 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5518.FG05677.1
Sequence length 108
Comment (Gibberella zeae)
Sequence
MAKQTSSSTTSSEQTQNIVSDIGEYLMQAAQNWAKMTDALVESRQVQQAVEDAHEQAMII
NHLSDLSTVVSMDVDLSKLCKIRDLTAQFSQDVHQVWQKDTRYNQNSS
Download sequence
Identical sequences A0A2H3GVN8 I1RNT7
XP_011324249.1.100342 5518.FG05677.1 FGSG_05677T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]