SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5518.FG06627.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5518.FG06627.1
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.41e-38
Family Calponin-homology domain, CH-domain 0.0000321
Further Details:      
 
Domain Number 2 Region: 162-228
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.83e-16
Family EB1 dimerisation domain-like 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5518.FG06627.1
Sequence length 241
Comment (Gibberella zeae)
Sequence
MGESRQELVAWLNSLLQLNITKVEQCGTGAALCQVFDSIYMDVPMSKVKFNVNSEYLYIQ
NFKVLQNTFAKHQIDKPIPVPSLIKCKMQDNLEFLQWTKRFWDLNFPDHEYDAVSRRKGG
SMPPSAAAPKPVSATTGAARRGGSTPSGGPRVAKAAGPATAALQQENATLKETVVGLERE
RDFYFSKLRDIELLVQTAVDEDPELEKLEDGLVKQIQTILYSTEEGFEIPAEGEVDDQET
F
Download sequence
Identical sequences A0A1B0P444 I1RRB0
FGSG_06627T0 XP_011326248.1.100342 5518.FG06627.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]