SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 557723.HAPS_0324 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  557723.HAPS_0324
Domain Number 1 Region: 35-175
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.78e-22
Family Ricin B-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 557723.HAPS_0324
Sequence length 176
Comment (Haemophilus parasuis SH0165)
Sequence
MLKRFTLLMTLGVCQFSLAETPPMPPAPTPTPSTYPDVVEIKPPIISLRSLNTGEPVSNR
SYDRNDPKEVQWRLVDVIVKNRRFVQFQVFGKENRCLVGDGGTLPCGQTDTLFRLVPTDT
GAFILTDPNTGKCLTSENYGSYGFQNCLRTSSAEPSNIPLKHLWIIAPPFGPSRLL
Download sequence
Identical sequences B8F3V7
gi|219870582|ref|YP_002474957.1| WP_012621670.1.83421 557723.HAPS_0324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]