SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 557723.HAPS_0513 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  557723.HAPS_0513
Domain Number 1 Region: 52-213
Classification Level Classification E-value
Superfamily Fic-like 2.35e-17
Family Fic-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 557723.HAPS_0513
Sequence length 220
Comment (Haemophilus parasuis SH0165)
Sequence
MTNEQKKALFSSTRMHSELVYNMTKLESNPYTYSEVKTLLDGITVGGRKLSDQEQVLRVS
HAWEELRSQIAQNTFTLTKENFIHFNQIVAENEALMVGSFRTGQVYIAGVEKYTPPKAEY
LDDIFTQMLNDFHQLDLNTHDKAFWLFLQCARHQFFYDGNKRTAQLMMNGFLLTNGLAVV
SIPARLKRSYDRKMTRFYDTNKMEPMMNFLRKLAASGRYE
Download sequence
Identical sequences B8F4C2
557723.HAPS_0513 WP_012621769.1.83421 gi|219870747|ref|YP_002475122.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]