SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 557723.HAPS_1267 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  557723.HAPS_1267
Domain Number 1 Region: 157-242
Classification Level Classification E-value
Superfamily OmpH-like 0.000000000000144
Family OmpH-like 0.007
Further Details:      
 
Domain Number 2 Region: 23-78
Classification Level Classification E-value
Superfamily OmpH-like 0.000017
Family OmpH-like 0.025
Further Details:      
 
Weak hits

Sequence:  557723.HAPS_1267
Domain Number - Region: 83-149
Classification Level Classification E-value
Superfamily OmpH-like 0.00471
Family OmpH-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 557723.HAPS_1267
Sequence length 267
Comment (Haemophilus parasuis SH0165)
Sequence
MKNLFKLAAVASALAFSANTVNANEKIGFVDPNFLIQNHPLTIEANDKFTKFMKDTESKF
APREKQLAAENKALSDEEKALLDERKKIEEDAQKLQKEQVTLEAAMKKKVAQLEKDAPRL
KAKEIQARQDKINAEAKPFQNKVSALQQREVEFGKKAEEFQKRADEFQKKVAAFQEEIAK
VQKESGVITPEQVQQKVVEDINAKIKQVAESKGYTLVLPPSVALYAKDGNAADITEEILV
AMGGKMPEAPKTEVPAAEVTKPEEVKK
Download sequence
Identical sequences A0A0E1RM16 B8F6A8 U4RV63
WP_005711020.1.19398 WP_005711020.1.36316 WP_005711020.1.36497 WP_005711020.1.41435 WP_005711020.1.42162 WP_005711020.1.45692 WP_005711020.1.53000 WP_005711020.1.54368 WP_005711020.1.58270 WP_005711020.1.69939 WP_005711020.1.71033 WP_005711020.1.76418 WP_005711020.1.83421 WP_005711020.1.9017 WP_005711020.1.9490 WP_005711020.1.98222 gi|514058822|ref|YP_008122903.1| 557723.HAPS_1267 gi|219871433|ref|YP_002475808.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]