SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 557760.RSKD131_0319 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  557760.RSKD131_0319
Domain Number 1 Region: 1-72
Classification Level Classification E-value
Superfamily L28p-like 4.91e-22
Family Ribosomal protein L28 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 557760.RSKD131_0319
Sequence length 84
Comment (Rhodobacter sphaeroides KD131)
Sequence
MTGNTVSHANNKSRRRFLPNLNDVTLISDVLGQSFKLRISAAALRTVDHRGGLDAFLAKA
KDDELSVKARAIKKEIEKAQATAA
Download sequence
Identical sequences B9KMW7
gi|221638418|ref|YP_002524680.1| 557760.RSKD131_0319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]