SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 557760.RSKD131_1029 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  557760.RSKD131_1029
Domain Number 1 Region: 29-171
Classification Level Classification E-value
Superfamily OmpH-like 1.57e-20
Family OmpH-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 557760.RSKD131_1029
Sequence length 230
Comment (Rhodobacter sphaeroides KD131)
Sequence
MHGLAAAALACVLALAGPAQAQSEAPQVPAGVAVIDQGRLITDTAMGRALEQRFQAASRA
LIAENREIEAALEAEERALTVRRANIEPAEFRRLASEFDAKVEGIRNAQEAKSRTLTRQR
DEERQRIVEQALPILARLMQDREALVLIDRASVVISRDAADITDEAIARLDALTPPAPAA
EEAPEPAGTSDGWAAPSGPGALLPPVSVPPAVGTAPETPDDRPQSPSATP
Download sequence
Identical sequences B9KRU7
gi|221639128|ref|YP_002525390.1| 557760.RSKD131_1029 WP_015920465.1.19875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]