SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 559307.ZYRO0A00572g from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  559307.ZYRO0A00572g
Domain Number 1 Region: 14-135
Classification Level Classification E-value
Superfamily Prefoldin 2.2e-25
Family Prefoldin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 559307.ZYRO0A00572g
Sequence length 161
Comment (Zygosaccharomyces rouxii CBS 732)
Sequence
MSSQRIDLTKLGPEQLAAVKQQIDQEFQHFNQSLQALTLARNRFQDCIEDIKSISSPENK
DQKIMVPASASLYIPGKIVENDKFMVDVGTGYYVEKTDTEAMSFYEHKIQKLNKESVQIQ
NIIKEKTSASLAIEAHIRQAAMSQHQEALKQQQAQQPTNAN
Download sequence
Identical sequences A0A1Q2ZSE4 C5DP56
559307.ZYRO0A00572g gnl|GLV|ZYRO0A00572g XP_002494400.1.66507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]