SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 565050.CCNA_00678 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  565050.CCNA_00678
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 8.9e-30
Family Ribosomal L11/L12e N-terminal domain 0.000043
Further Details:      
 
Domain Number 2 Region: 68-140
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 4.97e-22
Family Ribosomal protein L11, C-terminal domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 565050.CCNA_00678
Sequence length 143
Comment (Caulobacter crescentus NA1000)
Sequence
MAKKILGYIKLQVKAGSATPSPPIGPALGQRGVNIMGFCKEFNARTENVEKGTPLPTVIT
VYQDKSFTFITKTPPATHYLKQITGLKSGAKLTGRETVGEVTRTQLREIAEKKMKDLNAN
DLEAAAKIIEGSAKAMGLKIVEA
Download sequence
Identical sequences A0A2G5R3P3 B8H0P4 Q9AAF9
gi|221233615|ref|YP_002516051.1| 190650.CC_0641 565050.CCNA_00678 gi|16124894|ref|NP_419458.1| NP_419458.1.61804 WP_010918527.1.73756 YP_002516051.1.80956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]