SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 565050.CCNA_03009 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  565050.CCNA_03009
Domain Number 1 Region: 115-280
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 2.39e-63
Family NadC C-terminal domain-like 0.00000341
Further Details:      
 
Domain Number 2 Region: 5-114
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 2.28e-26
Family NadC N-terminal domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 565050.CCNA_03009
Sequence length 282
Comment (Caulobacter crescentus NA1000)
Sequence
MTLSPLPDLLVRPIVDLALAEDLGRAGDITGQACIDPDARLSVAFASRQDGRVSGLTCAR
LALAAMDPTARFEIVTPDGADVTPGAVLARAEGNARAVLIAERTGLNLLGRMSGIATLTR
AYVRLVEGTSATIVDTRKTTPGLRALEKYAVRCGGGVNHRFGLDDAILIKDNHVAACGGV
GEAVRRARAHAGHLVKVEVEVDGLDQLEEALKHGPDVVMLDNFSLADLRAAVALAKGRAV
LEASGGVNLTTVRAIAETGVDVISVGALTHSAPVLDIGLDAN
Download sequence
Identical sequences A0A0H3CB69 Q9A4C1
gi|16127145|ref|NP_421709.1| gi|221235945|ref|YP_002518382.1| 190650.CC_2915 565050.CCNA_03009 NP_421709.1.61804 YP_002518382.1.80956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]