SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5671.LinJ23.1310 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5671.LinJ23.1310
Domain Number 1 Region: 9-153
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.48e-18
Family Calponin-homology domain, CH-domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5671.LinJ23.1310
Sequence length 443
Comment (Leishmania infantum)
Sequence
MSARSAALSGRKELLQWLNKLCDADYPAVESLRDGAAYCTIVEAAVNRVAQNCAATQSSE
APVTKSCADRAHVYLGKLDWSATAAVCENADPSRDSVSVREVCFHNMRLLQDMLQECVPA
EHRNTVDANRLATGKLQDHVVLLRWLYLFMSKVLAQYSKKALEKKAGVVAGTVEGVKLNR
TVRLRSRQASSSDHRGARGLAQPHENKNDLMREENSTTPRWLHAARSPSGTSSRERAHRD
RGDSARDSNSPFRTPTGSNGGPAPAHTSSRGGLPDAGITTSSTSARATPATGPAKGYVSE
SAQEVLRERTVHAHYTRGTIAVPEVFRSTLVHLRDEVEELERQVLCAQERHNYHLTHRAS
EGETDRVLSVAAAKYDQDTSLGEEGRETLSLEELGELLEERDRLAQQYATVDAVVTRALQ
SARSQGKPIPPLLRDLVELLHPA
Download sequence
Identical sequences A4I0G7
5671.LinJ23.1310 psu|LinJ23_V3.1350 gi|146087398|ref|XP_001465808.1| XP_001465808.1.40037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]