SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 568703.LGG_02479 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  568703.LGG_02479
Domain Number 1 Region: 4-67
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 2.62e-22
Family Ribosomal protein L29 (L29p) 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 568703.LGG_02479
Sequence length 68
Comment (Lactobacillus rhamnosus GG)
Sequence
MGNQMKAKEITALTTAEMLDKEKQYKEELFNLRFQQATGQLENTARLKQVRKNIARIKTV
LRQQELNK
Download sequence
Identical sequences 568703.LGG_02479 568704.LC705_02480 gi|258509474|ref|YP_003172225.1| gi|258540671|ref|YP_003175170.1| gi|258509474|ref|YP_003172225.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]