SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5691.Tb09.160.1440 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5691.Tb09.160.1440
Domain Number 1 Region: 19-141
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.67e-17
Family Calponin-homology domain, CH-domain 0.00084
Further Details:      
 
Domain Number 2 Region: 490-536
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000379
Family EB1 dimerisation domain-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5691.Tb09.160.1440
Sequence length 536
Comment (Trypanosoma brucei)
Sequence
MDHRNTHGLVNIVPSRGTRTELLAWLNDLMPHVTASGYEVPRLRKVEHCGNGVPYVLLLP
QMLPFVHPALIARAKVPARHDFEAVSNLKLMADALQKNGIPPPEVLVDDVDKLIKGAFQA
NLQLLQWFRGLGDVLMPQNGRGEYSGETGYQRQPRYRHCDASEDASLISEQSQHSTSVGT
NDDKPAASRAVLPSRGDAPGLKRGSPRTTSVCCSGKLTPSTEPPVIQGPAAVSTSTLHTA
PVDGIKKSPISRRTSTPVDRSRVTTPAGARRLLDTNSTGPRGATQQSPTMRGRSNPRHSL
PGKEGSGFRPRTAFAGEAAAAVEDKQTPPLSTSESTTDDKDMTPMGEATTTKSGAVGPNI
VRRGRDQPMIPPKTNNAGSSSGVLSGSGDISERTCRPGGTTPVRTAVRSRNSLSGVVNPS
NVRERCAVDPHASVEMIVSPLMSKNASGKLLQSVSAATPSMSAGMSRSGSRGESSSEGDS
AVAAAALLKATRERQFYYDKLRQVEAIVLPLVDESSTDRSTRTLVTALLDVLYAAE
Download sequence
Identical sequences A0A1G4I5Q1 Q38FP4
XP_803586.1.54365 gi|146743428|gb|ABQ43160.1| gi|71744152|ref|XP_803586.1| Tb09.160.1440 5691.Tb09.160.1440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]