SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5691.Tb10.70.1730 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5691.Tb10.70.1730
Domain Number 1 Region: 14-153
Classification Level Classification E-value
Superfamily S13-like H2TH domain 3.29e-31
Family Ribosomal protein S13 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5691.Tb10.70.1730
Sequence length 153
Comment (Trypanosoma brucei)
Sequence
MSLTLQSESFQHIVRLLNTNVEGKRKVPFALRMVKGIGIRFAYMVCKKAGVDVERRAGTL
SPEELEKISEVIADPAKFKIPEWFLNRQRDPKTGKTEHLTSSMVDTRLREDLERLRKIRA
HRGVRHAYGLRVRGQHTCTSGRRGKTVGVSRTK
Download sequence
Identical sequences A0A1G4I1J9 D0A2S1 Q38B69
4v8m_AM gi|71747446|ref|XP_822778.1| gi|71747448|ref|XP_822779.1| 5691.Tb10.70.1730 5691.Tb10.70.1740 Tbg972.10.6510 Tbg972.10.6520 XP_011777829.1.14543 XP_011777830.1.14543 XP_822778.1.54365 XP_822779.1.54365 Tb427.10.5330 Tb427.10.5340 Tb927.10.5330 Tb927.10.5340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]