SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5722.A2D8L3 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5722.A2D8L3
Domain Number 1 Region: 10-110
Classification Level Classification E-value
Superfamily Bromodomain 2.09e-26
Family Bromodomain 0.00067
Further Details:      
 
Weak hits

Sequence:  5722.A2D8L3
Domain Number - Region: 89-164
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.000353
Family C-terminal domain of PLC-beta 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5722.A2D8L3
Sequence length 217
Comment (Trichomonas vaginalis)
Sequence
MSGIEKIKIEQALKVTRKMYENPAFALFRDPVDPATPGYYQSIKNPQDISSILGRLEKGQ
YLSFEKWRDDVKQIFTNCRKFNDQFEDLVDYANQCQAIFEKYMKELPPLTMSLMSTEMLS
QIDKLQKLFKNPPKAIKEILPKDNKYTHDQLNMQDSDKSKLLERINNFSSPDDILRVTHI
MEYFKIPKNSEHNGIINYSADKLTDEVYWNLGATFPK
Download sequence
Identical sequences A2D8L3
XP_001584248.1.43485 5722.A2D8L3 86498.m00549 gi|121918494|gb|EAY23262.1| gi|154422472|ref|XP_001584248.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]