SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5722.A2DBK2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5722.A2DBK2
Domain Number 1 Region: 25-213
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000235
Family 28-residue LRR 0.018
Further Details:      
 
Weak hits

Sequence:  5722.A2DBK2
Domain Number - Region: 212-241
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00772
Family Mitotic arrest deficient-like 1, Mad1 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5722.A2DBK2
Sequence length 280
Comment (Trichomonas vaginalis)
Sequence
MLSIEELKSIGGGEKNAFSFDLSSINSESLPALFAAIEKHGPYLIVSLNFNCDLVSDIDY
HNGDPESISRSIAVSTPNFAHLVALCVVSLLKKSKIIETLHLANIEFEESDILQIFKHII
PSKIHKFILHQVPLSPNAVSKIFKVITKHDIRSLTLRHCEITDESVPKIISCIKANRVQF
GKNLRKLDISDNDLSDDSLDQIGTILQTPISKIREEADDHSQEIERLRNENEDLKVQIER
LLLMQSEIENHNALFVIGEGAPQLIERMKSIGQRVQQLSQ
Download sequence
Identical sequences A2DBK2
5722.A2DBK2 83472.m00496 gi|121917431|gb|EAY22205.1| gi|154420352|ref|XP_001583191.1| XP_001583191.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]