SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5722.A2DMV2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5722.A2DMV2
Domain Number 1 Region: 8-170
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.81e-30
Family Calponin-homology domain, CH-domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5722.A2DMV2
Sequence length 196
Comment (Trichomonas vaginalis)
Sequence
MGIYGDYQKKREAAYDKRLEQRVRTWMETLIKHKIEGPTFQEGLKNMKALCDVINAVYPG
KIKRIRDSNVMLFCRENFGSFTQACLSIGVAQTDLCQFEDIYDNRNMGQFLVTMVSVARK
IQYSPGYHGPILEDAVKQATQNKRQFTETQLRAGESVLPLAQVGMNEASSAALEASRYVE
HGIIMDPALNPNNKRK
Download sequence
Identical sequences A2DMV2
5722.A2DMV2 XP_001579309.1.43485 gi|121913514|gb|EAY18323.1| gi|154412553|ref|XP_001579309.1| 88712.m00262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]