SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5722.A2DXT9 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  5722.A2DXT9
Domain Number - Region: 250-332
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00549
Family Myosin rod fragments 0.011
Further Details:      
 
Domain Number - Region: 351-416
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.018
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.014
Further Details:      
 
Domain Number - Region: 2-103
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0182
Family Calponin-homology domain, CH-domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5722.A2DXT9
Sequence length 439
Comment (Trichomonas vaginalis)
Sequence
MSEKAYAQWISSFPKVDDLNGNIMNLEDGKALIQVWNFIQDEKAEISDDSVKNATTLFEC
ISKTEYNIGSTNSSLSKDQIINIVRILYLLVNNSNHSSEIQEWTSKLSRATTIFLKKINK
DMIQQETTETHNNSNSNTNQEVSKRLKMIEKLKKQIKDSEQKIIDIKQQEKDTKNIQKTI
ETTEELIIHVENNQKEIQKQITEAEERYKLIKTEIESYKNDISQLSSENSSFTKIINSSN
EFAVLSTNYRKFKDYRSKINKLKEEIKNLQEKNSNFQKQITETQENIQTAIEIDLKYESD
NDITVDDEENASNINDLLSIVSELEIQIQDIKINDYSTSSIENGHLLKTIQELEETKTDL
QNKFEQISTQKKQLQLLIKSIADNYDNATENCNNIIDYVHSKNKVVANMSSLTSLLEKKS
MKKNINIRYREYIYNQDYQ
Download sequence
Identical sequences A2DXT9
XP_001327022.1.43485 87640.m00216 5722.A2DXT9 gi|121909945|gb|EAY14799.1| gi|123496683|ref|XP_001327022.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]