SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5722.A2E8X1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5722.A2E8X1
Domain Number 1 Region: 4-231
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.19e-65
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 539-660
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.04e-29
Family Synaptotagmin-like (S variant) 0.016
Further Details:      
 
Domain Number 3 Region: 839-966
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.79e-29
Family Synaptotagmin-like (S variant) 0.016
Further Details:      
 
Domain Number 4 Region: 694-804
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.96e-29
Family Synaptotagmin-like (S variant) 0.079
Further Details:      
 
Domain Number 5 Region: 245-369
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.37e-29
Family Synaptotagmin-like (S variant) 0.011
Further Details:      
 
Domain Number 6 Region: 995-1122
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.95e-28
Family PLC-like (P variant) 0.074
Further Details:      
 
Domain Number 7 Region: 397-533
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.25e-28
Family PLC-like (P variant) 0.043
Further Details:      
 
Domain Number 8 Region: 1139-1267
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.26e-26
Family Synaptotagmin-like (S variant) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5722.A2E8X1
Sequence length 1271
Comment (Trichomonas vaginalis)
Sequence
MPRSWEETQINTFTRWVNSYLRSRDLKVNDLKTDLCDGRLLINLCEILTKQTFPKKWHKT
PKLNMQKLENCHMAVDYINKDMQIKLVGIGGDDVNAGNLKLILGLIWSIINKYQVEAIQE
DFPQTEKKQSGKEKLLNWAKTATADHKGVNITDFSKSWRGGLPLCAIFHHYLPDCINYDS
IKPEDSINEAFSFMKRAGVNVFIDPQDLEVAAPDEKSIVTQVSELYHTFKKPEKVEAIHK
TLKPIPGFINCTVVNGRNLAAMDKGGKSDPYVIVKINKNGNPHKTEIIKETLNPDFNQDF
TIQFADQKVDSIILECYDWDDHNSHDLIGTAEIQLNQYVFNRVIERDIELKKEGGHRKER
GTIHFRFILLASLDNTDSEGEDNVVPEENATPVPPIVLNATVIDARDLPAMDADGQADPF
CILTVNGKGEQFKTRVIKNNLNPVWNHAFNIPINNQFTDTLYVNLIDFDETTNNDLIGYN
KISLRDLQIGKPEELQLPLRKLHAVRTDRGTVHLMLQAYKPGEEPEIMPPKEEEPEVKAF
VDCKVISATKLVAMDSNGKSDPYVVLKYNKDGEPQKTEICKKTLNPEWNQDFTFTVVQKK
TDILYVECWDWDDHNSHDLIGVGEVKIEEFMYDTLVETDVELKKEGGHRKERGTVHLRIF
VRTDRTGETDNEMGNTESEGEEAPSAQPAETATPIVVHCTVVDAKDLPAMDINGKADPFC
QLTVNGKGQEYKTEVVMKNKNPTWNQSFNIPVEDQNKDHLYVTLFDFDKDSDNDLIGYNR
IKLRDLPLNTPVEREVELKKKHGLRPDRGVAHLILTAYKPGEEPQIEATPVEEPVKSEVP
PKAEFLDCTVVSASNLVKMDKHGLSDPYVVLKVNKDGEPQKTEVVKQNLNPEWNQEFHFT
PVDKTKDVLVVECYDWDDHNSHDLIGNAILELAQYAYDIPIEADVELKKEGGHRKDRGTV
HLRFTIRKDKTGEPDDEHTTSEEENNKAVAKADPIVLHCTVVDGVELPAMDITGFSDPFV
RLTVNGQGKPYTTGIVMRELNPIWNQEFNIPIDNQNKDKLYITCYDWDEDSANDLIGYYR
LPLDDIKVGEPVERECILKKKHALRANRGKIHLKICAFKPGEEPQVSKVPGAHPIKNIKP
KETLLDATVVNARDLVPMDKNGKSDPYVILKLNRNGIPQQTTVVKASLNPDINENFDFTL
IDPKTDVLLVYCYDWDDHNNHDLIGVGEIPLEGIALDVPVEKQVELKKEGGHRKERGKVN
LKLRLHNSRDG
Download sequence
Identical sequences A2E8X1
XP_001323176.1.43485 gi|121906035|gb|EAY10953.1| gi|123480041|ref|XP_001323176.1| 5722.A2E8X1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]