SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5722.A2F1C4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5722.A2F1C4
Domain Number 1 Region: 6-145
Classification Level Classification E-value
Superfamily MTH1598-like 1.7e-33
Family MTH1598-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5722.A2F1C4
Sequence length 145
Comment (Trichomonas vaginalis)
Sequence
MYTEAKWEFIDHPADIQLHAWGPQPDVTLEQLGKAFFEVMFETDNFKEETTHSISVKGKD
AQNLLYNFLDEWLYVFDAEDFVATRIKVTKCDFVNLEIEATGYGELFDMKKHADFRRTEV
KAITYASMKVDTTPGASEFYVILDL
Download sequence
Identical sequences A2F1C4
5722.A2F1C4 gi|121896127|gb|EAY01288.1| gi|123974994|ref|XP_001314095.1| XP_001314095.1.43485 93909.m00090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]