SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5722.A2FGR1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5722.A2FGR1
Domain Number 1 Region: 5-108
Classification Level Classification E-value
Superfamily Bromodomain 3.27e-31
Family Bromodomain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5722.A2FGR1
Sequence length 150
Comment (Trichomonas vaginalis)
Sequence
MSEKLSDYDKSWISRVLVDLFKWPLTQQFRQPVDPVRDGVENYFDIIKNPVDLSTMKKKL
NEGTYKTIQQFTDDIHLMYENSLQYNGNSSYFTYIAADIEKWYLNRLKLKGNNAEEEWKN
RVFEIIEKLNEHRKLNPAERMPLSAVADHE
Download sequence
Identical sequences A2FGR1
gi|121890526|gb|EAX95897.1| gi|123434629|ref|XP_001308827.1| XP_001308827.1.43485 5722.A2FGR1 90451.m00078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]