SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5722.A2G1X0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  5722.A2G1X0
Domain Number - Region: 4-93
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0245
Family Calponin-homology domain, CH-domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5722.A2G1X0
Sequence length 153
Comment (Trichomonas vaginalis)
Sequence
MDSYDSTIDPQEVFTEMNNNGTMNYLKTKEINLTLQTLLKFKPKLINNTFLLTDANSFRK
DQYMLSHEAILAYLKQKGLKLTLNSITAEYPDKYPLIPKKSMIPIKLKIQENVDPIKELI
KNRIKPSKAKFKPQPVQTPTNVSDSDPGLDLSD
Download sequence
Identical sequences A2G1X0
5722.A2G1X0 81955.m00032 XP_001301779.1.43485 gi|121883002|gb|EAX88849.1| gi|123401022|ref|XP_001301779.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]