SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5722.A2GV38 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  5722.A2GV38
Domain Number - Region: 38-90
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000301
Family Pentapeptide repeats 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5722.A2GV38
Sequence length 96
Comment (Trichomonas vaginalis)
Sequence
WVCCCIICIIIAIISSVGDAGAGVVPSWDIRSSVMSLQKTALQKTALQKTALQKTALQKT
ALQKTALQKTALQKTALQKTALQKTALQKTALQKTS
Download sequence
Identical sequences A2GV38
XP_001291910.1.43485 gi|121866681|gb|EAX78980.1| gi|123314783|ref|XP_001291910.1| 5722.A2GV38

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]