SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5722.A2HZS0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  5722.A2HZS0
Domain Number - Region: 5-50
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000702
Family Chromo domain 0.017
Further Details:      
 
Domain Number - Region: 40-96
Classification Level Classification E-value
Superfamily FYSH domain 0.012
Family Hypothetical protein Yhr087W 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5722.A2HZS0
Sequence length 118
Comment (Trichomonas vaginalis)
Sequence
MRKRKEIEYVVSERIVKQYFVKYKDQHPEINKWVYQNEIPQEIVEKYLETKKTENIDEML
RCTRIVHVVDQDKKEFYLEFSKKNQIHHILNKNLDEEHQKAYIDYLESLLKLEIKNKN
Download sequence
Identical sequences A2HZS0
5722.A2HZS0 gi|121823726|gb|EAX65097.1| gi|123154460|ref|XP_001278027.1| 134597.m00002 XP_001278027.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]