SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 573370.DMR_12360 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  573370.DMR_12360
Domain Number 1 Region: 5-117
Classification Level Classification E-value
Superfamily Translational machinery components 6.11e-49
Family Ribosomal protein L18 and S11 0.0000596
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 573370.DMR_12360
Sequence length 119
Comment (Desulfovibrio magneticus RS 1)
Sequence
MKMTKTLARARRKVRIRKKLSGTVERPRLVVYRSNRHIYAQVIDDLTGQTLVSSSSLTLL
RAGEAVKADKEAATMVGKDLAAKALERNIQAVVFDRNGYIYHGRVQALADGARDGGLKF
Download sequence
Identical sequences C4XLY9
WP_015859942.1.87776 gi|239905874|ref|YP_002952613.1| 573370.DMR_12360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]