SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 573370.DMR_38360 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  573370.DMR_38360
Domain Number 1 Region: 13-186
Classification Level Classification E-value
Superfamily Macro domain-like 7.74e-54
Family Macro domain 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 573370.DMR_38360
Sequence length 189
Comment (Desulfovibrio magneticus RS 1)
Sequence
MPGHAAYDIGPGSLRLIEGDITVDDADAIVNAANSALAGGGGVDGAIHRAAGPKLPAACR
DIIARIGSLPAGGAVITPGFELPARHIIHTVGPIWRGGETGEPEALRSAYAQSINRAVEH
GLTTVAFPAVSTGVYGFPVHLAAPIALGVMAEALRGGRLREVRMYLHGTAAFGVWRSAAD
ALFGGNAGE
Download sequence
Identical sequences C4XN24
573370.DMR_38360 gi|239908471|ref|YP_002955213.1| WP_015862467.1.87776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]