SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 573370.DMR_42090 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  573370.DMR_42090
Domain Number 1 Region: 157-214
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000000497
Family MgtE N-terminal domain-like 0.012
Further Details:      
 
Weak hits

Sequence:  573370.DMR_42090
Domain Number - Region: 112-171
Classification Level Classification E-value
Superfamily OmpH-like 0.017
Family OmpH-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 573370.DMR_42090
Sequence length 224
Comment (Desulfovibrio magneticus RS 1)
Sequence
MGERFVTACERLAGRIAPRATKVLGVFVMLAAIKLGILVFMGLDMLLPDPPAPVATAPRL
PVAPLPGPLAGPVPVLAQQNPLPPATVPPSPAPAAPTPGSPDVNALLKRQDELDQREQSL
KTLEAELGNRMTKLKDMETNLKAMLEEAKGIKDQKLKHLIDVYSNMNAKQAAKVLETLDN
AIAVKILAGMRGRQAGDVLNNMEAKKAAGLTEMLTSMQLPPQAE
Download sequence
Identical sequences C4XQ00
573370.DMR_42090 WP_015862825.1.87776 gi|239908844|ref|YP_002955586.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]