SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 573826.CD36_10560 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  573826.CD36_10560
Domain Number 1 Region: 4-106
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.22e-35
Family Calponin-homology domain, CH-domain 0.000057
Further Details:      
 
Domain Number 2 Region: 235-289
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000000000942
Family EB1 dimerisation domain-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 573826.CD36_10560
Sequence length 296
Comment (Candida dubliniensis CD36)
Sequence
MVVGESRAELLNWLNSTLDLNYTKIEQCGSGAAFCQLMDTIVGDVPLSKVKFNAKTEYEF
RHNYKILQHVFVKNSITKTIDVEKLIRCKLQDNLELLQWIKRYASSNNVPMKTTVARQPP
KQTTKPSTGSPESSPINAGPSAAPLISKPRERKSNTPLGSRKTSSNGPINLTPTAVRSTN
VAASKNNNRSGNGTIINNGHVPVVSASEPVAATGTAAVAAAVATTDSGATSSIPEDFAIY
SQHVESERDFYFNKLRAIEILVQHAKEMEGLSGDVLQFANEIEKIMYEEYVEDDEF
Download sequence
Identical sequences B9W9C8
573826.CD36_10560 XP_002417698.1.45354 Cd36_10560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]