SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 575788.VS_0815 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  575788.VS_0815
Domain Number 1 Region: 53-130
Classification Level Classification E-value
Superfamily FlaG-like 2.09e-21
Family FlaG-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 575788.VS_0815
Sequence length 141
Comment (Vibrio splendidus LGP32)
Sequence
MEILSNASNIQPYGSPNGIKFASDKGSSASSTLQPKETTSYDKVEKSKEMATEAAIQLAQ
HRQELNDAERVKMVEKVNEFISSLNKGVAFKVDEETGRDVVTIYETTTGDIIRQIPDEEM
LEILRRLAAQTSNSGILEAKV
Download sequence
Identical sequences B7VKN3
575788.VS_0815 WP_012603434.1.409 gi|218708815|ref|YP_002416436.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]