SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 575788.VS_2823 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  575788.VS_2823
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 4.97e-23
Family Ribosomal protein L29 (L29p) 0.0000841
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 575788.VS_2823
Sequence length 64
Comment (Vibrio splendidus LGP32)
Sequence
MMKAQDLREKNVEELNAELLNLLREQFNLRMQAATGQLQQTHTLKAVRRDIARVKTVLTE
KAGA
Download sequence
Identical sequences B7VLE9
gi|218710741|ref|YP_002418362.1| 575788.VS_2823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]