SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5807.cgd1_710 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5807.cgd1_710
Domain Number 1 Region: 6-112
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000044
Family Calponin-homology domain, CH-domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5807.cgd1_710
Sequence length 1171
Comment (Cryptosporidium parvum)
Sequence
MPEGRKLIQIGKKELLAWGSSLLGEELNWKSFSDGTVLLKFCFIVWPSLNNTKTEIDALS
DSWRKIETIFRTLSIDYSKLIDEEGIKNDKLCSAYNSVIIFFFLYHCAFKNESSFEFIPP
PSKHIVEFLMGDSSIKTLIVGGSLQLSPKTQIRLFENDSKAPNKLSEVPTEAVRYFKGDE
GVYYDRIQRFNEVMDMDERTVKLVQSIDNFFEGLNDKFSEINQINLPDEIENFTTKVRHS
LEYCVRQLVRTKEEQAIERANYENRIKTIEEDCEKKIEQLKLTYEEKIREIENEGKQKII
QEKKASQMMLRTMQNNQTLNLQMSGSIYKDYHNGDLSLEELSTKIKGETIEQLKYLQEIV
NEENKKRDEIEKTLNDEISSYQKENKRLRYMIYRYVVDVSSSTPQFDRLREINDQFVKIY
TLAENWWKKITDSCENTMSERSDLNYKMERMRMDEVLGHLKHILDKYQEYPKGLNKVGLN
QASKSSNFEFEVLVQNNHLVNDCLKIVCDLVSESLLKSNRIDQLKDIILNTDGNQKINHH
FDHQYKDENQCYCNSNDLFGSVYGKIVCNDEKKHLKEKVQHLSHEKLLLQRGIEFLKKKL
YTLKNQQLIVSSENYESNLDLMASIDKPLGETEIDSQEIIQVSDLWDISNYLKEDGINDL
TIMSEFLVVMNRWKKLAKYTIENDDDISELKSHSELRKKYSDHSSKGGISIQGFNLLPFI
TSSNKLIEIALENDFSQNEFFEQVKKLESQEFDLEGDFEKELSMISKITTLNHANIYGQA
EKDEDQTFPSSLIKIEIMFWKLVTCLHILREEYKLLKAHKVALENKLETVLAVMEEEKTK
YEENIKLNQEKHIKALQNEKTDYQMKIGKLKAQLTLIKVEKHAAVNKPRNFTVSIESKEK
LKGIKKVVETLSTGLEVSNAFRFIYQVSDELWNSLFDILKEHINDNQVEEKVTEISDQLK
GLRQYLKEYSESQTMKIQKGNTENQEHDDISEYVSSKLMEIGDNSGLGLNIHQKLTSFLK
DLAVKNSIPLDWLQFVEMIVSARTIELNNEIDLLKQQITDQDEIISNLKQEYTEISRLNT
ENESELETICLERRNLQEKLELIDQELNIYRSNNELLKEKFKEADSYYNNQLLSCNKRLN
CLEKICLLSMDFGVKIQYFRDFYDSKIINLK
Download sequence
Identical sequences Q5CSZ6
XP_627921.1.25317 gi|46227556|gb|EAK88491.1| gi|66361914|ref|XP_627921.1| 5807.cgd1_710 gb|cgd1_710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]