SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5807.cgd3_1080 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  5807.cgd3_1080
Domain Number - Region: 7-86
Classification Level Classification E-value
Superfamily SNARE-like 0.00366
Family Synatpobrevin N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5807.cgd3_1080
Sequence length 114
Comment (Cryptosporidium parvum)
Sequence
MEWKLYIWIPPLDKGKIAYSVCCKNEKYPERLIYSYLRELNKSTLRIERINENMPNKINE
LNGIKNFKEDIKSLVSQYDDFENFDKIVQLEDSAKEIAGTIQNNIQILLNNKVS
Download sequence
Identical sequences Q5CUX8
XP_626686.1.25317 5807.cgd3_1080 gi|46228268|gb|EAK89167.1| gi|66359016|ref|XP_626686.1| gb|cgd3_1080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]