SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 582744.Msip34_0999 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  582744.Msip34_0999
Domain Number - Region: 97-174
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0471
Family BCR-homology GTPase activation domain (BH-domain) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 582744.Msip34_0999
Sequence length 179
Comment (Methylovorus SIP3 4)
Sequence
MATASNTRNTTQKMHPMATILFGSRWLQLPLYLGLIVAQGVYVFHFMVELVHLVQKVPDM
HEADIMLIVLGLIDVVMISNLLIMVIVGGYETFVSRLNLKGHPDEPDWLSHVNANLLKVK
LATAIIGISSIHLLKTFINAPNLDDKTMLWQTVIHMAFVLSAVSIAWIDRLMTHADNKH
Download sequence
Identical sequences C6XCH1
WP_015829772.1.76919 gi|253998710|ref|YP_003050773.1| 582744.Msip34_0999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]