SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5833.PFC0365w-1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5833.PFC0365w-1
Domain Number 1 Region: 227-282,321-532
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.05e-54
Family WD40-repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 4-54
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000274
Family U-box 0.0051
Further Details:      
 
Domain Number 3 Region: 110-168
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 0.0000497
Family Tubulin chaperone cofactor A 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5833.PFC0365w-1
Sequence length 532
Comment (Plasmodium falciparum)
Sequence
MSIICTISGQTPEEPVISKTGYIFEKRLIEKHIINYGICPVSGEVLTLEDLYPIKNEKIV
KPRPITASSIPGLLSIFQTEWDSIISEMFSLRTHVNDIRNELSHSLYQYDAATRVIAKLL
KEKNGYKEEIENLKKQIFQLKSSNDLDIYEIGLNEELLEKMQNVAKDLLINRKKRKIDNV
CSVEQWKDFKNTNEFNIHSSTIPGVTCITLDVNKYKYNYNDDHMKHNFFSGGNDGNVYYV
SLNDNKILSKLQGHLKKVNSIISHPSNFICITASNDKTIRIWKGDDNNVHHNDNGDSDSD
NNNNNNDNDGSHLNNNEYIYDNYQFVSAHVITKHKDHVTSLALHPLENYFISSSKDSMWI
LHDLETAKTIKTSKDNPSSFKHLAIHPDGMMFGIAAQDSNIHIYDIKSQEYKATLNGHTK
SLNCLSFSENGYYLASSSKDNTVKLWDLRKAQSFQTITLNETPNFISFDYSGKYLSIAVE
NDIQIYNFETKNQANLIKTLSSHTDIVTQTCFGSTTSYILSSSMDKTIKLWN
Download sequence
Identical sequences A0A024VE39 A0A024WET5 A0A024WXP1 A0A024XET3 A0A0L1I3E9 A0A0L7K7G8 O77325 W4IND6 W4ISC5 W7G4F2 W7JIH5 W7KCS8
PFC0365w NYSGXRC-T265 5833.PFC0365w-1 XP_001351160.1.26446 PFHG_01085T0 gi|124504835|ref|XP_001351160.1| gi|3649760|emb|CAB11109.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]