SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5833.PFC0445w-1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5833.PFC0445w-1
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily SNARE-like 7.6e-31
Family Sedlin (SEDL) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5833.PFC0445w-1
Sequence length 145
Comment (Plasmodium falciparum)
Sequence
MYSLYVNNQHGTLVYQKHFSEEIKLNSNEEIRLASMLHGISTISEKINVYSLYEKKTNIF
QSLEKKGIETIEGDGFKIQCYDTLTGIKIFIVHKDDLNIEMNTYLKRVYELYSDIILKNP
FYDIDMPIRSAVFNEQIEKLFSNIS
Download sequence
Identical sequences A0A024WE88 A0A024XE27 A0A060RNF2 A0A0L7KBI7 A0A2I0BTT2 O77358 W4IPY9 W4IQG2 W7FMG2 W7G1G6 W7JUH5
5833.PFC0445w-1 XP_001351180.1.26446 XP_012761180.1.2076 gi|124504875|ref|XP_001351180.1| gi|7672214|emb|CAA15613.2| NYSGXRC-T270 PFC0445w PFHG_02029T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]