SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5833.PFL2095w-1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5833.PFL2095w-1
Domain Number 1 Region: 17-114
Classification Level Classification E-value
Superfamily eIF1-like 2.88e-31
Family eIF1-like 0.000077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5833.PFL2095w-1
Sequence length 115
Comment (Plasmodium falciparum)
Sequence
MNLAIQNLGINDPFTNENIVDKGNGKSNATNLIHIRNQQRNGRKSVTTVQGLGKTFDLKK
MVRALKKEFNCNGTIIEDIEHGSIIQLQGDKRNNVKEFLIREGICALEHIRIHGA
Download sequence
Identical sequences A0A024W4T7 A0A024WMN7 A0A024X3F1 A0A060RWI7 A0A151L358 Q8I4Z4 W4IE17 W7FEB9 W7J928 W7KC28
PFL2095w XP_001350823.1.26446 XP_012764297.1.2076 XP_018638915.1.24268 gi|124806752|ref|XP_001350823.1| gi|23496952|gb|AAN36503.1| 5833.PFL2095w-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]