SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 583345.Mmol_1260 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  583345.Mmol_1260
Domain Number 1 Region: 44-132
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 0.0000000641
Family Chemotaxis phosphatase CheZ 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 583345.Mmol_1260
Sequence length 182
Comment (Methylotenera mobilis JLW8)
Sequence
METKTLPIAELRKLLAAVSDHGKQHLVEVEADLLQTTFLLSEAIEKLSTSFTAVHDAVCA
QQQVLDALVAKYAIEEPILEKLDSYKSKIGNEVNVVITSLQFQDLTSQLVARTIKRVNGL
KDLLHELEAHSNEMDPGHEHEEIVKFLEEMNRSLQVGSSALSGGLRKSVGQQDMATGEID
LF
Download sequence
Identical sequences C6WW67
WP_015832201.1.100669 583345.Mmol_1260 gi|253996629|ref|YP_003048693.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]