SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5850.PKH_090980 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  5850.PKH_090980
Domain Number - Region: 30-122
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00304
Family Calponin-homology domain, CH-domain 0.011
Further Details:      
 
Domain Number - Region: 179-236
Classification Level Classification E-value
Superfamily PF0523-like 0.0157
Family PF0523-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5850.PKH_090980
Sequence length 291
Comment (Plasmodium knowlesi)
Sequence
MNSLERKLKLLNYKPVDIGKDEFYYMILKLEEEKIRLYKPKEREKINYTKEKNYIEHILK
YLKKLNINVRNVNKTNIHEVGVRTYILNSLATLALIDEYKDLVGYDQSCGEQCDNRNYEN
GKDALNGGTAHHAGQHRADDSANLQNQYIVANFFELNYLNQAELEEQRKRRDNLRVLNEQ
INEIFKKCDIPLLVCNDQDGDKWMYLIQSALHAIKEKLKKKTKTNNPHYESLFNFNISFT
NSNLKDFAYITRYLLNSVLKERETHLKGVLNDIQMLTYNPVIDIRQGKVGR
Download sequence
Identical sequences A0A1A7VDG7 A0A1Y3DNQ8 B3L4S7
PKH_090980 5850.PKH_090980 gi|193809196|emb|CAQ39898.1| gi|221055974|ref|XP_002259125.1| XP_002259125.1.91479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]