SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5850.PKH_140170 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5850.PKH_140170
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily SNARE-like 2.52e-23
Family Synatpobrevin N-terminal domain 0.042
Further Details:      
 
Domain Number 2 Region: 117-183
Classification Level Classification E-value
Superfamily SNARE fusion complex 9.42e-17
Family SNARE fusion complex 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5850.PKH_140170
Sequence length 208
Comment (Plasmodium knowlesi)
Sequence
MSIIYGLVARDKTVLAEYTEFGGNFSNISRLLLEIIPPHSARKSYIYDDYVFHQLMKNGI
TFMAMTDKELGFLTPYAFLEEISKVFFKHFNYTSDFIALSLDEEFKPVLRENMRIFNNYE
SNDVHNIKNKISNIQNIIIENIEKILERREKIDILVNKSEKLYQENISFRRQAMRLNFFM
WMEDNRFLIYFISSIAIFVFLIWSFYNV
Download sequence
Identical sequences A0A1A7VV98 A0A1Y3DKN6 B3LBJ3
5850.PKH_140170 PKH_140170 XP_002261924.1.91479 gi|193811074|emb|CAQ41802.1| gi|221060709|ref|XP_002261924.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]