SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5855.PVX_091850 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5855.PVX_091850
Domain Number 1 Region: 147-249
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 1.16e-20
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.0019
Further Details:      
 
Domain Number 2 Region: 251-305
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 2.35e-16
Family Head domain of nucleotide exchange factor GrpE 0.0029
Further Details:      
 
Weak hits

Sequence:  5855.PVX_091850
Domain Number - Region: 78-179
Classification Level Classification E-value
Superfamily Ribosomal proteins L15p and L18e 0.048
Family Ribosomal proteins L15p and L18e 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5855.PVX_091850
Sequence length 306
Comment (Plasmodium vivax)
Sequence
MKYAHFFLRRGVSCRSPLNACGVQRAAFRRYYFASVCPNEICGKVVQGRLFSSRAGMSDG
GARRGVEAQNGSSGIEESRKDGEMGENGGKGGKGEKGMKGEKGEDGQHGQFDQFDQQGKH
TEGAEQKKEQMKETNYEKLNKADLINEIKKTKRDIEEKMVDNKILKEKYLSVLAENENLR
HRYVKEIENSKLYCISNFAKSLLDVADNLSLAIKNINEESLKQNEEISNIYKGIQMTETI
LHNIFNKYGIDKYDPINEKFNPLFHEALFEINDDTKEKGTVATVVQQGYKIKDRILRAAK
VGVVKN
Download sequence
Identical sequences A0A0J9SEU9 A0A0J9SWL6 A0A0J9TD33 A0A0J9TV80 A0A1G4HCW0 A5K4Q7
gb|PVX_091850 XP_001615362.1.43797 gi|156098693|ref|XP_001615362.1| 5855.PVX_091850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]