SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5855.PVX_117335 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5855.PVX_117335
Domain Number 1 Region: 5-98
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000377
Family Calponin-homology domain, CH-domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5855.PVX_117335
Sequence length 757
Comment (Plasmodium vivax)
Sequence
MEIPREVIKWLQYLNLPYSFRNIKNASNGVIVAEILNIYLPQTINMNSLENGFGKEIKKK
NWQVIKRTLTSLGISFDETAVINSDKNAIINLFVQLYEHFNGKKIKNELYCSKEEGSELS
VPSFARSTITQKVRESNVHDIVDEEKKMMSTYEIIKREEYQNAMMRTRQKEEKENSNKIK
QKGKQTGLNETSIFEGLEKSSSIITINDISNYMDYTDIKTLDSFIKDKNNLKSTAFMKSM
KVTNEGECQQVHQKGYTDENVEDIIAEVLAESLSDYKMEEDDERDGKRDDKNVPLLPANT
KKGGYKFATFEPSDEECANNLYEKFYAVCAFQKQELVDKILDQLTLYNENFHLILSLRGA
KCDCGVFTSIMNYLKQLLGYLKINDTTTSEIICNIILKGMFVLDTGGNKNIRSFCELLIL
LIQNDRHSLMNILRVIKDTMSLDFFYLFLLTLLRSQANSFIRQKDVKDIYLYYLFAGLHT
SRENIMLYSLEMLNMLSLLDVYPEIVHLAGLLQNILEINNRSYDTYLFTISCNVVCKMKE
NQKEDPYSAELAQLVGICLEVLRRTKAKKLLYFFFLYSHKILSMNDGFFDLYLKRYNELS
DEEQKVLLSNNIFEASFRQACSCKFVKKHFSNIFCENLNMLSEEMFICMLKKYPFVNLLF
LENLEMLAYLKIYEKIYEYTIRNIFLENSPDFDSSKEILNFFWFSTNDELKAQSFEISLS
HFEKLFLENKHNLGPHTKEYLAHPLFIYPFFVSDVLR
Download sequence
Identical sequences A0A0J9SQB9 A5K3D1
XP_001615762.1.43797 gi|156100069|ref|XP_001615762.1| gb|PVX_117335 5855.PVX_117335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]