SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5855.PVX_118105 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5855.PVX_118105
Domain Number 1 Region: 1-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.27e-19
Family Calponin-homology domain, CH-domain 0.0023
Further Details:      
 
Weak hits

Sequence:  5855.PVX_118105
Domain Number - Region: 1498-1650
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.085
Family Extended AAA-ATPase domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5855.PVX_118105
Sequence length 1732
Comment (Plasmodium vivax)
Sequence
MEKNNAIGKEQLVCWVKKLLKRNHFHFGELKDGGVYVELLQCIWPQMVKRYEERYQHRGE
YEEKEKTNWRVIHSTLKDLNIDSDFISYNQICEGHFSSCYQSLILLFFLHSLVKHHECDF
VLAYPVTKRLTDFMSSEEPLNCLVRAGSVQLPQKFFKNVSNCFQVNNSTVMDGKRRDSPL
EVEKPQNCVFARSAYQSHHSDFSNGLNNSHPHRVNEKKSTSLSSPELVPSSADGCAAKRD
KSYTCRGDSLLSLVSGTSTATGSSGGGNHPRDTPERGSSTTGGAAYQGRAPPINSVDKKR
TDETAIGEKPLNKEGSNEPPIRSNAPYSFDQMVTQPRSNFFKYFNKTDVGKSEILEKAPH
EDRKSVSPEAPHLNVPPPPTTSSSSCADEHKPIRADVKETKVDASCQAENDPFFNFLLNH
DSVENLKVTWNDEEKNVKGESFIWFLKTQVKMYKRELRLREEELELTSQMKKKEMEDLKM
VHSVELAMLQEKHQAQIFYLKQQHLEGEAKMRKQFEAKISNMEEDLTLDLDVLHCQERGS
LLGSLPGEEEEWAKGDEERSTSTQGHKHRPKHGCGRQYGGDATQGEDTLVDHDEEDANIN
RFLFDQVDVVSVLGGETPGGDHYRDDIPKKKKFLNFDYCLENGAVREAPKGAPEGEDHRA
MYTETAAELTANTNSNIREAINKMRQLVSKKNMEHEINNKCLRGEMEILRNAVENFKSRR
ASESDLVKESAQVVSELLQSIDREQEGEEVPPKGWNIFTYVEKEQSKIYEMIKKGHNGPL
KSDEVVKILDGSSLIRLLVRVVCALKLERVKRRLGGERATSKESERRSERRGEPGASCTF
LPNDTPSNEIKTIEREMETAEHIKRVERKNKRLQCLNEYYKKRLGHLEVWTHALENLKSR
CKQFYTESGTHAFTSGGEERALHECAVVPSGGPSDEASSSEQLSYERLSHERLSHERLSH
ERLSTTQLTPARLAPKSASTQPSAALPPFLWSPEFYLRSFAEENERDAELMRLLKLLGRC
ENEEDVLLFQSDTPVRCGRSDREEESSKRVEEDERQPHPDKLMLSVRPNEAWLKKKLTHN
FWLMLGDIYSYRNVIVEACHYICQSNSMMSRYITTSEQKMREERRQFENACNGKDTVHRA
EKYKWRQLIGTATFNRDLYKEKYMQLQRENQKEKKNLLHLTNLCYEQESVKYRNTILKLR
QADHNYRVYKAREKKWVQLAKLLITELTNSSKGNQEEVKDAWLEIVAAEKEKEKKRGRKK
KCLQVGDPNWESHIEEGTSNDACARVVAGTALLTPIGQNTKEAASLGGTDQGGENQLGKG
SSTSCTRGHIGPHTRGGTTIRSSTTNRCSSNNRCGSNNLGAPSKGGRKSAHRGGSHNMHR
QDSSMCKQASPTGWGAKRTSAEQDEGGSEPNRSRDYFTEGHADYYVKDFHTFLNDVQSSC
VLNFSSASEADIWASEGGESGVESGRESGSDVRLATSKNAIQTAVQMANNNADHGVEAWE
TRLKQMAEESCAMFQRVLGMKEEEIKEWKKQTGHLEGELNEMKKQNQSQQNKYACLKEQQ
SDLVKRLGSLSDIISDLNDQMYQLKREKIDSENRSLTKQQHLHTLVRNYECTIKLIKSHL
KKYPSVLYLVDTVTDEDKGVILELASAGEKYNAGESYKEGLSFSLQEDKHTHVKAKQNCV
IKSVARETATNEGSQVWANLEEANMSIGGEDKSEGSPDFSLTDLMRDMGWDT
Download sequence
Identical sequences A5K3T3
XP_001615914.1.43797 5855.PVX_118105 gi|156100373|ref|XP_001615914.1| gb|PVX_118105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]