SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5855.PVX_119485 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5855.PVX_119485
Domain Number 1 Region: 10-139
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.39e-39
Family Calponin-homology domain, CH-domain 0.000025
Further Details:      
 
Domain Number 2 Region: 372-432
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.000000000000811
Family EB1 dimerisation domain-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5855.PVX_119485
Sequence length 560
Comment (Plasmodium vivax)
Sequence
MSEGREASSLGMMDSAFFVSRKELIEWVNRTLKLNVTKIEQCSNGAIYTQLLDILFPNKS
VLHKVKWNAKLEYECIINYKLIQNVFNKLGIKKHMDIDKLIRGKYQDNLEFLQWFKAFFE
RIIDYNNENVINYDPLERRKMCVLGDRGDYKLLNSYLPDWAKVDMHNGKEKVRHNENRAC
SNGSKRNNDFRSSVNQDNVTCSVATRAATTSSNNSSAANLCQPHAGRKIMKTEKRSAWLS
MAGDNNVGLLSCKEVHDSKRHPSGASHQGATHQGASHQGATHQGASHQGATHQGMTHLGN
HLPATTSTNKRLSVSAKLSASAKLSSRGSLSSSTYYHPSKNNPHVENHKDALSLNEQNRK
FKIQLEKKNSEIVSLQDKLKAQEKEKKLLLFQKNFYYNKLRFLELLCNQTDDDSLLVSDI
QHIIYARENTYFHQTISLGGKGSGDGVEPSEVAPSEADPNEVDPNEVYPNEVDPNEVYPN
EVDPNEVYPNEVDAAHSGKATHSGDAYAETDNEAPLPHAHDRYNAHDFPEQTDSIHNGEV
EQYGGQYNNQGSMDFPAYCS
Download sequence
Identical sequences A5KB89
gb|PVX_119485 XP_001613094.1.43797 gi|156094113|ref|XP_001613094.1| 5855.PVX_119485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]