SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5874.Q4UCY5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  5874.Q4UCY5
Domain Number - Region: 139-184
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0806
Family Calponin-homology domain, CH-domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5874.Q4UCY5
Sequence length 764
Comment (Theileria annulata)
Sequence
MVLIKNLNVYIIFLDMLLSFFGLYVTPIMYSLFNTASKSSLFQDRNFVTVDELLHSDLGL
STTIDLWDLILMFSHLLKYYKVEMSVGDSLLMNIRLFVVFIIFVLVTVFLFGLVIPAVDG
DYKAEHKIKSNLFNQTLHFFIKLLQHFTKKNNTIDTIVTNKQLKNTWDKNENVEYVLKSV
EEINSVDMFTMAKFTFIIGFFLIDIPFLMYRLYILIKYNVFSLLLYKNFMFLFLRPYRLN
MSQLAERDTTKGYEHLLFTQTSNSINNSITHHTLLNNFQDDDPIDLLKKYDKTEKKIHKS
VLTPILKQKTLIKRDQIKSDPTPFNFLNNSRLLNGKPGLPNGKSGLLSGKPGLLNGRTGL
FGLKTRLFNDRTGLPNGKTRLFDKKDRLNMVKMMSRSKLIPMRSYPFTLILHHWVLFLFP
KQRAEVTNFPKFITVKHIWSCIIVVFSNIIPRFIIVLLYLTQNIRSPREILVNSSNFEKI
LIEITLIFPIVTFIFSIKTCGIFDSAFLLFREIVSLLTFSTCLYSFKLLLETYKLYKHLY
ILLILIIKPLIIIFDFFIIFFQTINNSVKNNKFNSVNNSVNSSVKRNSVENSVENSVNSS
VNNSIESLDYKSILLYKILKRSIGGIMLNSKICNDDIILMLKWHDKLFHSQWSEIIVSIP
FKIICSCNLTSKISILILISDIIFSLIYCLMSQSARVLMLRKYEVNYIVMRVMKLDTNDW
DDLDSPEHCITLAEVDKYINTQGLLSSPGLNLFGYRVLNKVPFV
Download sequence
Identical sequences Q4UCY5
TA03435 5874.Q4UCY5 gi|85000147|ref|XP_954792.1| XP_954792.1.9581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]